HORDB

ID: hor002039
Uniprot ID: P01148
Protein name: Progonadoliberin-1
Gene name: GNRH1
Organism: Homo sapiens (Human)
Family: GnRH family
Source: Human
Expression: NA
Disease: Diseases associated with GNRH1 include Hypogonadotropic Hypogonadism 12 With Or Without Anosmia and Normosmic Congenital Hypogonadotropic Hypogonadism.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
GO BP: GO:0000003 reproduction; GO:0007165 signal transduction; GO:0007267 cell-cell signaling; GO:0010468 regulation of gene expression; GO:0045471 response to ethanol; GO:0048545 response to steroid hormone; GO:2000354 regulation of ovarian follicle development; GO:2001223 negative regulation of neuron migration
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Length: 69
Propeptide: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Signal peptide: MKPIQKLLAGLILLTWCVEGCSS
Modification: T1 Pyrrolidone carboxylic acid;T10 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Mechanism: The 3D-structure was determined for the synthetic analog Triptorelin.
Cross BBB: NA
Target: GNRHR
Target Unid: P30968
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002039_AF2.pdb

hor002039_ESM.pdb

Mass:	910692	Formula:	C344H551N101O110S
Absent amino acids:	M	Common amino acids:	E
pI:	5.7	Basic residues:	12
Polar residues:	17	Hydrophobic residues:	19
Hydrophobicity:	-92.46	Boman Index:	-18018
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	74.93
Instability Index:	6425.07	Extinction Coefficient cystines:	6990
Absorbance 280nm:	102.79